PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C002616P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 183aa    MW: 19553.5 Da    PI: 9.4511
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C002616P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.22.1e-391775462
          zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    +++kcprCds+ntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvP+Ggg+rk+k+ +
  MELO3C002616P1 17 QKQKCPRCDSSNTKFCYYNNYSLSQPRYFCKSCRRYWTHGGTLRNVPIGGGSRKSKRPK 75
                    6789***************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-25773IPR003851Zinc finger, Dof-type
PfamPF027014.5E-341773IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.051973IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102157IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MQGAPNEDQT KASTIIQKQK CPRCDSSNTK FCYYNNYSLS QPRYFCKSCR RYWTHGGTLR  60
NVPIGGGSRK SKRPKSTLLP SSSSSSDTTT TLTPPPPVGS GPLDLATASS YNSSAAFLPS  120
LDVGAAYSSF GGLAWTTTPI NNTIITNNHS SSSGNNQNSS FQIDNNSSAL LPNHLSPFHH  180
PE*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819320.0LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008442727.11e-131PREDICTED: dof zinc finger protein DOF2.2-like
TrEMBLA0A0A0LXF41e-89A0A0A0LXF4_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41453258
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.14e-32TARGET OF MONOPTEROS 6